CASP4 Target T0088
-
1. Protein Name
- GafD
-
2. Organism Name
- E.coli
-
3. Number of amino acids (approx)
- 156
-
4. Accession number
- AAA85086
-
5. Sequence Database
- GenBank
-
6. Amino acid sequence
-
AVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRI
SGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTA
MSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILKRNSSAQYSVQKTSI
GSIRMRPYNGSS
-
7. Additional Information
- This is an engineered N-term
fragment which is proteolytically stable in E.coli.
-
8. Homologous Sequence of known structure
- no
-
9. Current state of the experimental work
-
Good protein supply.
Crystals diffracting to 2.5A have been obtained.
Seleno-methionine substitution to be used.
-
10. Interpretable map?
- no
-
11. Estimated date of chain tracing completion
- 9/2000
-
12. Estimated date of public release of structure
- 12/2001
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file