CASP4 Target T0087
-
1. Protein Name
- PPase
-
2. Organism Name
- Streptococcus mutans
-
3. Number of amino acids (approx)
- 310
-
4. Accession number
- AAC05778
-
5. Sequence Database
- GenBank
-
6. Amino acid sequence
-
MSKILVFGHQNPDSDAIGSSMAYAYLKRQLGVDAQAVALGNPNEETAFVLDYFGIQAPPVVKSAQAEGAK
QVILTDHNEFQQSIADIREVEVVEVVDHHRVANFETANPLYMRLEPVGSASSIVYRLYKENGVAIPKEIA
GVMLSGLISDTLLLKSPTTHASDPAVAEDLAKIAGVDLQEYGLAMLKAGTNLASKTAAQLVDIDAKTFEL
NGSQVRVAQVNTVDINEVLERQNEIEEAIKASQAANGYSDFVLMITDILNSNSEILALGNNTDKVEAAFN
FTLKNNHAFLAGAVSRKKQVVPQLTESFNG
-
7. Additional Information
- New class of PPase.
Homologs,
B.subtilus swissprot P37487
M.jannaschii swissprot Q58025
-
8. Homologous Sequence of known structure
- no
-
9. Current state of the experimental work
-
We have a steady supply of large quantities of protein.
Crystals diffracting to 3A have been obtained from two
different conditions. Selenomethionine substitution for
MAD phasing is underway.
-
10. Interpretable map?
- no
-
11. Estimated date of chain tracing completion
- 08/2000
-
12. Estimated date of public release of structure
- 01/2001
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file