CASP4 Target T0086
-
1. Protein Name
- chorismate lyase
-
2. Organism Name
- E. coli
-
3. Number of amino acids (approx)
- 164
-
4. Accession number
- P26602
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
- SHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQ
GKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCA
DGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSST
LTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY
-
7. Additional Information
- protein is a monomer
crystal pH 7.0
no disulfides
-
8. Homologous Sequence of known structure
- no
-
9. Current state of the experimental work
- structure recently solved and just refined at 1.5A resol.
R=0.20 Rfree=0.21 rmsd bonds 0.018 A
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- 4/23/00 exactly
-
12. Estimated date of public release of structure
- 4th week of July, 2000
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file