CASP4 Target T0128
-
1. Protein Name
- Manganese superoxide dismutase homolog
-
2. Organism Name
- Pyrobaculum aerophilum
-
3. Number of amino acids (approx)
- 222
-
4. Accession number
-
5. Sequence Database
-
6. Amino acid sequence
-
MRGSHHHHHHGSVTTKRYTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEK
LEKFRKGEAQIDIRAVLRDLSFHLNGHILHSIFWPNMAPPGKGGGKPGGKIADLINKFFG
SFEKFKEEFSQAAKNVEGVGWAILVYEPLEEQLLILQIEKHNLMHAADAQVLLALDVWEH
AYYLQYKNDRGSYVDNWWNVVNWDDVERRLQKALNGQIALKL
-
7. Additional Information
-
crystallized at pH 7.5.
oligomeric state: tetramer
-
8. Homologous Sequence of known structure
- yes
-
9. Current state of the experimental work
-
diffracted up to 1.8 angstrom.
molecular replacement solution is in hand.
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- August 31, 2000
-
12. Estimated date of public release of structure
- December 31, 2000
-
13. Name
- Unavailable until after public release of structure
-
Related Files
Template Sequence file
Template PDB file