CASP4 Target T0126
-
1. Protein Name
- Olfactory Marker Protein
-
2. Organism Name
- Mouse
-
3. Number of amino acids (approx)
- 163
-
4. Accession number
- B54261
-
5. Sequence Database
- PIR
-
6. Amino acid sequence
-
MAEDGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLI
RPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLT
NLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKV
MYFLITFGEGVEPANLKASVVFNQL
-
7. Additional Information
-
Crystalization pH 6.5
monomer, no cystine
Crystalized w/ 200mM Zinc Acetate
-
8. Homologous Sequence of known structure
- no
-
9. Current state of the experimental work
-
Solved with SeMet MAD.
Refinement complete to 2.35 Angstrom.
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- 04/15/2000
-
12. Estimated date of public release of structure
- 11/1/2000
-
13. Name
- Unavailable until after public release of structure
-
Related Files
Template Sequence file
Template PDB file