CASP4 Target T0121
-
1. Protein Name
- MalK
-
2. Organism Name
- Thermococcus litoralis
-
3. Number of amino acids (approx)
- 372
-
4. Accession number
- Q9V306
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MAGVRLVDVWKVFGEVTAVRELSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDRLV
ADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELSGGQRQR
VALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEV
YDKPANTFVAGFIGSPPMNFLDAIVTEDGFVDFGEFRLKLLPDQFEVLGELGYVGREVIFGIRPEDLYDAMFARVRVPGE
NLVRAVVEIVENLGSERIVHLRVGGVTFVGAFRSESRVREGVEVDVVFDMKKIHIFDKTTGKAIF
-
7. Additional Information
- N-terminal part has sequence similarity to known structure
-
8. Homologous Sequence of known structure
- yes
-
9. Current state of the experimental work
-
MAD X-ray structure at 1.86A (Rfree=28% R=22%)
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- now
-
12. Estimated date of public release of structure
-
after publication; manuscript in preparation; will be sent in soon
-
13. Name
- Unavailable until after public release of structure
-
Related Files
Template Sequence file
Template PDB file