;  SAM: prettyalign v3.3.0 (January 24, 2000) compiled 02/10/01_22:08:06
;  (c) 1992-2000 Regents of the University of California, Santa Cruz
;
;          Sequence Alignment and Modeling Software System
;         http://www.cse.ucsc.edu/research/compbio/sam.html
;
; ----------------- Citations (SAM, SAM-T99, HMMs) --------------------
; R. Hughey, A. Krogh, Hidden Markov models for sequence analysis:
;  Extension and analysis of the basic method, CABIOS 12:95-107, 1996.
; K. Karplus, C. Barrett, R. Hughey, Hidden Markov models for detecting
;  remote protein homologies, Bioinformatics 14(10):846-856, 1998.
; A. Krogh et al., Hidden Markov models in computational biology:
;  Applications to protein modeling, JMB 235:1501-1531, Feb 1994.
; ---------------------------------------------------------------------
; Sequences correspond to the following labels:
; 1 T0118
; 2 2pviA
; 3 2pviA
                      10        20        30        40        50       
                      |         |         |         |         |       
   1 ........MAGYGAKGIRKVGAFRSGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFL
   2 ms100pwi-------------------------------------------------------FA
   3 shp99pwi-------------------------------------------------------FA


       60        70        80        90       100       110       120  
       |         |         |         |         |         |         |  
   1 LPNGIFVETKGLWESDDRKKHLLIREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEKHGIKFAD
   2 IYRGIAIEAIYRLEPKDLEFYYDKWER--------------------------------------
   3 IYRGIAIEAIYRLEPKDLEFYYDKWER--------------------------------------


           130       140               150
            |         |                 |
   1 KLIPAEWIKEPKKEVPFDRLKRKGGKK.........
   2 ---------------------------kwy28kiy.
   3 ---------------------------kwy28kiy.