CASP4 Target T0115
-
1. Protein Name
- Homoserine kinase
-
2. Organism Name
- Methanococcus jannaschii
-
3. Number of amino acids (approx)
- 300
-
4. Accession number
- Q58504;
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MREIMKVRVKAPCTSANLGVGFDVFGLCLKEPYDVIEVEAIDDKEIIIEVDDKNIPTDPDKNVAGIVAKK
MIDDFNIGKGVKITIKKGVKAGSGLGSSAASSAGTAYAINELFKLNLDKLKLVDYASYGELASSGAKHAD
NVAPAIFGGFTMVTNYEPLEVLHIPIDFKLDILIAIPNISINTKEAREILPKAVGLKDLVNNVGKACGMV
YALYNKDKSLFGRYMMSDKVIEPVRGKLIPNYFKIKEEVKDKVYGITISGSGPSIIAFPKEEFIDEVENI
LRDYYENTIRTEVGKGVEVV
-
7. Additional Information
- forms homodimer.
-
8. Homologous Sequence of known structure
- no
-
9. Current state of the experimental work
-
Structure just solved at 2.1A by X-ray crystallography.
-
10. Interpretable map?
- no
-
11. Estimated date of chain tracing completion
- completed already
-
12. Estimated date of public release of structure
- October, 2000
-
13. Name
- Unavailable until after public release of structure
-
Related Files
Template Sequence file
Template PDB file