CASP4 Target T0113
-
1. Protein Name
- Short chain 3-hydroxyacyl-coa dehydrogenase
-
2. Organism Name
- Rattus norvegicus
-
3. Number of amino acids (approx)
- 261
-
4. Accession number
- O70351
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MAAAVRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNS
EGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEK
KNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQV
GQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVP
FPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
-
7. Additional Information
-
pH = 7.5
tetramer
no disulphides
in the structure the first 6 amino acids are disordered
-
8. Homologous Sequence of known structure
- yes
-
9. Current state of the experimental work
-
Structure is solved to 1.4 Angstroms resolution by
molecular replacement using pdb entry 2hsd
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- completed
-
12. Estimated date of public release of structure
- iminent
-
13. Name
- Unavailable until after public release of structure
-
Related Files
Template Sequence file
Template PDB file