CASP4 Target T0110
-
1. Protein Name
- HI1288
-
2. Organism Name
- Haemophilus influenzae
-
3. Number of amino acids (approx)
- 128
-
4. Accession number
- P45141
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MAREFKRSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHD
EMAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGMRMSNLVTNVVREDE
KKHVEESN
-
7. Additional Information
- ribosome binding factor A
-
8. Homologous Sequence of known structure
- no
-
9. Current state of the experimental work
-
Refined x-ray crystal structure to 1.55A.
-
10. Interpretable map?
- no
-
11. Estimated date of chain tracing completion
- Completed
-
12. Estimated date of public release of structure
- Oct-00 or Nov-00
-
13. Name
- Unavailable until after public release of structure
-
Related Files
Template Sequence file
Template PDB file