CASP4 Target T0105

1. Protein Name: Sp100b
2. Organism Name: Homo sapiens
3. Number of amino acids (approx): 94
4. Accession number: P23497
5. Sequence Database: Swiss-prot
6. Amino acid sequence: DENINFKQSELPVTCGEVKGTLYKERFKQG
TSKKCIQSEDKKWFTPREFEIEGDRGASKN
WKLSIRCGGYTLKVLMENKFLPEPPSTRKKVTIK
7. Additional Information: This is the so-called SAND domain (or KDWK domain) from Sp100b.
This is the domain selected from the protein which was considered
most likely to be responsible for the predicted DNA-binding activity
of the protein.
8. Homologous Sequence of known structure: no
9. Current state of the experimental work: We are refining the NMR structure of the sequence given above and hope
to have published the 3D structure by September.

the protein was expressed in E coli at high levels (>10mg/L) and
is readily soluble in typically-used Tris or sodium phosphate buffers
in a pH range 5-9. No crystallisation trials have been performed.
10. Interpretable map?: yes
11. Estimated date of chain tracing completion: Structure already determined, requires refinement.
12. Estimated date of public release of structure: August/September 2000
13. Name: Unavailable until after public release of structure