CASP3 Target T0084
-
1. Protein Name
- rlz
-
2. Organism Name
- artificial
-
3. Number of amino acids (approx)
- 37
-
4. Accession number
- not available
-
5. Sequence Database
- none
-
6. Amino acid sequence
- CGGREGVLKKLRAVENELHYNKSLLEEVKDELQKMRQ
-
7. Homologous Sequence of known structure
- no
-
8. Current state of the experimental work
-
Data collected to 2.1 Ang. resolution.
Structure solved by molecular replacement.
Present status: under refinement.
-
9. Interpretable map?
- yes
-
10. Estimated date of chain tracing completion
- finished
-
11. Estimated date of public release of structure
- 01.01.1999
-
12. Additional Information
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file