CASP3 Target T0080
-
1. Protein Name
- 3-methyladenine DNA glycosylase
-
2. Organism Name
- human
-
3. Number of amino acids (approx)
- 219
-
4. Accession number
- P29372
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
KGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLG
PEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACV
LLRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINK
SFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYV
RGSPWVSVVDRVAEQDTQA
-
7. Homologous Sequence of known structure
- no
-
8. Current state of the experimental work
-
The structure has been solved to 2.7 A.
We have submitted it for publication and are awaiting a decision.
-
9. Interpretable map?
- yes
-
10. Estimated date of chain tracing completion
- done
-
11. Estimated date of public release of structure
- 10/98
-
12. Additional Information
- The crystal structure is
of a protein-DNA complex.
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file