CASP3 Target T0077

1. Protein Name: L30 (former L32)
2. Organism Name: Saccharomyces cerevisiae
3. Number of amino acids (approx): 105
4. Accession number: 172488
5. Sequence Database: Genbank
6. Amino acid sequence: MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYF
QGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
7. Homologous Sequence of known structure: no
8. Current state of the experimental work: The protein was expressed in E. coli for NMR structure determination.
This is an RNA binding protein that binds to ribosomal RNA, and it also binds
to its own mRNA for translational regulation. We have complete proton, nitrogen, and carbon assignments, and
large NOE datasets for the free form of the protein, as well as the protein bound to its RNA target.
The conformation of the protein is extremely similar in both forms.
We have structures for the bound form in hand with rmsd for backbone atoms
of < 1 angstrom (as of 7/28/98).
9. Interpretable map?: yes
10. Estimated date of chain tracing completion: done
11. Estimated date of public release of structure: anticipate 12/98
12. Additional Information
13. Name: unavailable until after public release of structure