CASP3 Target T0076
-
1. Protein Name
- cdc4p
-
2. Organism Name
- Schizosaccharomyces pombe
-
3. Number of amino acids (approx)
- 140
-
4. Accession number
- L42454
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
STDDSPYKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIEST
LPAEVDMEQFLQVLNRPNGFDMPGDPEEFVKGFQVFDKDATGMIGVGELR
YVLTSLGEKLSNEEMDELLKGVPVKDGMVNYHDFVQMILAN
-
7. Homologous Sequence of known structure
- yes
-
8. Current state of the experimental work
-
Structure determined by NMR
-
9. Interpretable map?
- yes
-
10. Estimated date of chain tracing completion
- Completed
-
11. Estimated date of public release of structure
- Oc. 98
-
12. Additional Information
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file