CASP3 Target T0066

1. Protein Name: SinI and SinR
2. Organism Name: Bacillus subtilis
3. Number of amino acids (approx): 57 and 111
4. Accession number: P23308 and P06533
5. Sequence Database: Swiss-Prot
6. Amino acid sequence: SinI

MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAAR
SHTVNPF

##################################################

SinR

MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKV
SAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLD
YQKWRKSQKEE
7. Homologous Sequence of known structure: no
8. Current state of the experimental work: X-ray structure solved and refined of the heterodimeric
complex of SinI and SinR. Manuscript submitted.
9. Interpretable map?: yes
10. Estimated date of chain tracing completion: finished
11. Estimated date of public release of structure: september 1998
12. Additional Information
13. Name: Dr. Rick Lewis
14. Mailing address: Department of Chemistry
University of York, York
North Yorkshire YO1 5DD
U.K.
15. Telephone: +44 (0)1904 432590
16. Fax: +44 (0)1904 410519
17. Email: rick@yorvic.york.ac.uk
18. Source of information about experiment: Email

Note for predictors: This target should be used only to submit predictions for the structure of SinR and SinI complex. To submit predictions for individual components please use targets T0064 (for SinR) and T0065 (for SinI).

Related Files

Template Sequence file

Template PDB file