CASP3 Target T0055
-
1. Protein Name
- Polyandrocarpa lectin
-
2. Organism Name
- Polyandrocarpa misakiensis
-
3. Number of amino acids (approx)
- 125
-
4. Accession number
- P16108
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MDYEILFSDETMNYADAGTYCQSRGMALVSSAMRDSTMVKAILAFTEVKGHDYWVGADNL
QDGAYNFLWNDGVSLPTDSDLWSPNEPSNPQSWQLCVQIWSKYNLLDDVGCGGARRVICE
KELDD
-
7. Homologous Sequence of known structure
- yes
-
8. Current state of the experimental work
-
9. Interpretable map?
- yes
-
10. Estimated date of chain tracing completion
- 18.05.98
-
11. Estimated date of public release of structure
- 31.08.98
-
12. Additional Information
-
C-type lectin family, Polyandrocarpa lectin recognises Galactose
-
13. Name
- Sebastien Poget
-
14. Mailing address
-
Centre for Protein Engineering
Lensfield Road
Cambridge CB2 1EW
UK
-
15. Telephone
- +44 - 1223 - 336 358
-
16. Fax
- +44 - 1223 - 336 445
-
17. Email
- sfp22@cam.ac.uk
-
18. Source of information about experiment
- Email
Related Files
Template Sequence file
Template PDB file