CASP3 Target T0046
-
1. Protein Name
- gamma-adaptin ear domain
-
2. Organism Name
- Mouse
-
3. Number of amino acids (approx)
- 118
-
4. Accession number
- P22892
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
- IPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLL
SPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
-
7. Homologous Sequence of known structure
- no
-
8. Current state of the experimental work
- solved
-
9. Interpretable map?
- yes
-
10. Estimated date of chain tracing completion
- March 1998
-
11. Estimated date of public release of structure
- October 1998
-
12. Additional Information
-
13. Name
- P.R.Evans
-
14. Mailing address
-
MRC Laboratory of Molecular Biology
Hills Road
Cambridge CB2 2QH
UK
-
15. Telephone
- +44 1223 248011
-
16. Fax
- +44 1224 213556
-
17. Email
- pre@mrc-lmb.cam.ac.uk
-
18. Source of information about experiment
Related Files
Template Sequence file
Template PDB file