;  SAM: prettyalign v2.2.1 (October 5, 1998) compiled 10/06/98_17:37:09.
;  SAM:  Sequence Alignment and Modeling Software System
;  (c) 1992-1998 Regents of the University of California, Santa Cruz
;  http://www.cse.ucsc.edu/research/compbio/sam.html
;
; ------ Citations (HMMs, SAM) ------
; A. Krogh et al., Hidden Markov models in computational biology:
;   Applications to protein modeling, JMB 235:1501-1531, Feb 1994.
; R. Hughey, A. Krogh, Hidden Markov models for sequence analysis:
;   Extension and analysis of the basic method, CABIOS 12:95-107, 1996.
; -----------------------
                            10        20        30        40        50
                             |         |         |         |         |
1lmb3 STKKkpltqeqledarrlKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAAL
T0083 ----xiqsqinrnirldlADAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARL


              60                                                      
               |                                                      
1lmb3 LAKILKVSVEEFSpsiareiyemyeavs....................................
T0083 VGAKLDLDEDSILllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgiisai


                                       
                                       
1lmb3 .................................
T0083 nfkldvkkvadpeggeravitldgkylptkpf.