; SAM: /projects/compbio/experiments/protein-predict/SAM_T08test/bin_freeze/sam/prettyalign v3.5 (July 15, 2005) compiled 04/12/08_09:06:02 ; (c) 1992-2001 Regents of the University of California, Santa Cruz ; ; Sequence Alignment and Modeling Software System ; http://www.cse.ucsc.edu/research/compbio/sam.html ; ; ----------------- Citations (SAM, SAM-T2K, HMMs) -------------------- ; R. Hughey, A. Krogh, Hidden Markov models for sequence analysis: ; Extension and analysis of the basic method, CABIOS 12:95-107, 1996. ; K. Karplus, et al., What is the value added by human intervention in protein ; structure prediction, Proteins: Stucture, Function, Genetics 45(S5):86--91, 2001. ; A. Krogh et al., Hidden Markov models in computational biology: ; Applications to protein modeling, JMB 235:1501-1531, Feb 1994. ; --------------------------------------------------------------------- ; Sequences correspond to the following labels: ; 1 T0460 PF0246, Pyrococcus furiosus, 111 residues ; 2 gi|18976618|ref|NP_577975.1|_1:103 hypothetical protein PF0246 [Pyrococcus furiosus DSM 3638] >gi|18892185|gb|AAL80370.1| hypothetical protein [Pyrococcus furiosus DSM 3638] ; 3 gi|14521894|ref|NP_127371.1|_1:102 hypothetical protein PAB1233 [Pyrococcus abyssi GE5] >gi|5459114|emb|CAB50600.1| Hypothetical protein [Pyrococcus abyssi GE5] ; 4 gi|57641721|ref|YP_184199.1|_1:102 hypothetical protein TK1786 [Thermococcus kodakarensis KOD1] >gi|57160045|dbj|BAD85975.1| hypothetical protein, conserved [Thermococcus kodakarensis KOD1] ; 5 gi|14591662|ref|NP_143749.1|_1:102 hypothetical protein PH1920 [Pyrococcus horikoshii OT3] >gi|3258362|dbj|BAA31045.1| 102aa long hypothetical protein [Pyrococcus horikoshii OT3] 10 20 30 40 50 60 | | | | | | 1 MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKY 2 MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKY 3 MNSEVIKEFLEDIGADYIELEGEIHLEPRVFYEVWKYVGEPELKTYVVEDEVVEPGEYDPPEMKY 4 MHFEVVKEFLEDIGADWIEIEGEIHLDPEVFYEVWKYVGQPELKTYVIEDEVVEPGSYDPPEMKY 5 MNSEVIKEFLEDIGADYIELEGEIHLEPKVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMRY 70 80 90 100 110 | | | | | 1 TNVKKVKIKKVYFETLDNVRVVTDYSEFQKILKKRGTKLEHHHHHH 2 TNVKKVKIKKVYFETLDNVRVVTDYSEFQKILKKRGTK-------- 3 TEARKIKIKKVYFETLDGVKVVTDYSDFQKILKETKA--------- 4 TDVKKVKIKKVYFETLDGKKIVTDYSEFQKLVKEKSA--------- 5 TEAKKIKIKKVYFETLDGVKVVTDHSEFQKIIKEMKS---------