PFRMAT RR TARGET T0429 AUTHOR 4008-1775-0004 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: con.aa5str2_5near5nsep5.entmi_epplccrr.th62.17.730_47.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 RKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARART IIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETR 110 119 0 8 0.193576 110 120 0 8 0.2304 110 121 0 8 0.0814851 110 123 0 8 0.103219 110 124 0 8 0.085631 110 128 0 8 0.173559 110 129 0 8 0.18059 110 130 0 8 0.218223 110 131 0 8 0.255752 110 132 0 8 0.378611 110 133 0 8 0.281646 110 134 0 8 0.421317 111 128 0 8 0.116129 111 129 0 8 0.0794386 111 130 0 8 0.0736361 111 131 0 8 0.0906489 111 132 0 8 0.191333 111 133 0 8 0.168045 111 134 0 8 0.219644 112 121 0 8 0.141946 112 123 0 8 0.13301 112 124 0 8 0.138149 112 128 0 8 0.170341 112 129 0 8 0.153735 112 130 0 8 0.200617 112 131 0 8 0.17375 112 132 0 8 0.248141 112 133 0 8 0.254818 112 134 0 8 0.279328 112 135 0 8 0.22726 113 123 0 8 0.118415 113 124 0 8 0.133941 113 128 0 8 0.154264 113 129 0 8 0.211304 113 130 0 8 0.146327 113 131 0 8 0.223406 113 132 0 8 0.269986 113 133 0 8 0.32502 113 134 0 8 0.302419 114 123 0 8 0.199743 114 124 0 8 0.285868 114 128 0 8 0.273727 114 129 0 8 0.198922 114 130 0 8 0.198542 114 131 0 8 0.208373 114 132 0 8 0.33933 114 133 0 8 0.365451 114 134 0 8 0.386335 114 135 0 8 0.25165 115 124 0 8 0.367394 115 128 0 8 0.331743 115 129 0 8 0.238114 115 130 0 8 0.654833 115 131 0 8 0.338274 115 132 0 8 0.476305 115 133 0 8 0.418946 115 134 0 8 0.535691 115 135 0 8 0.301709 116 127 0 8 0.110456 116 128 0 8 0.221627 116 129 0 8 0.34037 116 130 0 8 0.442259 116 131 0 8 0.611953 116 132 0 8 0.656977 116 133 0 8 0.61499 116 134 0 8 0.647233 116 135 0 8 0.367492 116 137 0 8 0.278684 117 128 0 8 0.263438 117 129 0 8 0.323368 117 130 0 8 0.535938 117 131 0 8 0.687559 117 132 0 8 0.737644 117 133 0 8 0.643834 117 134 0 8 0.67964 118 128 0 8 0.279203 118 129 0 8 0.333581 118 130 0 8 0.515656 118 131 0 8 0.6738 118 132 0 8 0.777058 118 133 0 8 0.581445 118 134 0 8 0.752134 119 128 0 8 0.307077 119 129 0 8 0.424778 119 130 0 8 0.444236 119 131 0 8 0.621693 119 132 0 8 0.677464 119 133 0 8 0.634387 119 134 0 8 0.504864 120 129 0 8 0.37969 120 130 0 8 0.420956 120 131 0 8 0.488174 120 132 0 8 0.576167 120 133 0 8 0.392498 120 134 0 8 0.407238 121 130 0 8 0.269605 121 131 0 8 0.321544 121 132 0 8 0.342483 121 133 0 8 0.210554 121 134 0 8 0.21243 122 131 0 8 0.229989 122 132 0 8 0.322818 122 133 0 8 0.149167 122 134 0 8 0.247217 123 132 0 8 0.101145 123 133 0 8 0.0612805 123 134 0 8 0.0849079 123 135 0 8 0.0615209 124 133 0 8 0.0515259 124 134 0 8 0.0895524 124 135 0 8 0.0514873 125 134 0 8 0.0951785 125 135 0 8 0.0572588 126 135 0 8 0.0654793 126 136 0 8 0.0764987 126 137 0 8 0.0924667 127 136 0 8 0.0594669 127 137 0 8 0.0600046 128 137 0 8 0.134245 129 138 0 8 0.195908 129 141 0 8 0.147532 130 141 0 8 0.251584 131 140 0 8 0.238175 131 141 0 8 0.18644 132 141 0 8 0.210234 END