PFRMAT RR TARGET T0295 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.5xnearNS_str2.miRpz_entR_pplR.n45.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDI DSRMISEVKKRCLYEGYNNLEVYEGDAIKTVFPKFDVCTANIPYKISSPL IFKLISHRPLFKCAVLMFQKEFAERMLANVGDSNYSRLTINVKLFCKVTK VCNVNRSSFNPPPKVDSVIVKLIPKESSFLT 12 25 0 8 0.287160152203 12 27 0 8 0.277839621067 12 34 0 8 0.390345112686 12 35 0 8 0.354464043916 12 38 0 8 0.318902857948 12 45 0 8 0.296633007605 12 58 0 8 0.343586304433 16 34 0 8 0.319222899662 23 43 0 8 0.292915027668 23 46 0 8 0.432625343804 23 85 0 8 0.329930421858 24 38 0 8 0.275302322314 24 45 0 8 0.580558945483 24 46 0 8 0.324252397394 24 47 0 8 0.273460356436 24 69 0 8 0.269825106322 24 70 0 8 0.409310756962 24 85 0 8 0.264036271625 25 34 0 8 0.281903264201 25 38 0 8 0.364938614286 25 42 0 8 0.263941608618 25 45 0 8 0.540057832397 25 46 0 8 0.655926573606 25 47 0 8 0.485129936445 25 48 0 8 0.466200716645 25 58 0 8 0.412749182278 25 67 0 8 0.27795154446 25 70 0 8 0.416060878345 25 72 0 8 0.460563278146 25 85 0 8 0.537040670411 25 86 0 8 0.263668029274 25 88 0 8 0.31908364487 26 46 0 8 0.265008275286 26 47 0 8 0.546910616041 26 48 0 8 0.265316987293 26 49 0 8 0.393540128987 26 51 0 8 0.398639996466 26 72 0 8 0.267870352518 26 90 0 8 0.320907533485 27 38 0 8 0.353165527648 27 45 0 8 0.398048241867 27 46 0 8 0.421553636417 27 47 0 8 0.59473701414 27 48 0 8 0.534493275219 27 49 0 8 0.378664108239 27 50 0 8 0.3923688618 27 58 0 8 0.307737421369 27 70 0 8 0.264344658329 27 72 0 8 0.509351923077 27 73 0 8 0.316945643653 27 77 0 8 0.30518353726 27 88 0 8 0.333571161224 27 89 0 8 0.282700400264 27 90 0 8 0.420393094284 28 47 0 8 0.355522795974 28 48 0 8 0.380108431341 28 49 0 8 0.349637711261 28 75 0 8 0.265739930435 28 90 0 8 0.345507770443 28 91 0 8 0.425661331239 29 38 0 8 0.272308369535 29 47 0 8 0.60551082121 29 48 0 8 0.474557806139 29 49 0 8 0.502518478416 29 50 0 8 0.278103440492 29 51 0 8 0.343586304433 29 54 0 8 0.377775294023 29 58 0 8 0.649101709976 29 74 0 8 0.277542821937 29 90 0 8 0.29109612956 29 91 0 8 0.320687170261 29 92 0 8 0.273454475248 29 94 0 8 0.298064885932 29 95 0 8 0.320622357548 29 96 0 8 0.298192534913 29 97 0 8 0.264396056113 29 111 0 8 0.283987254902 29 114 0 8 0.340371853731 29 115 0 8 0.298424230673 29 119 0 8 0.396031244696 30 47 0 8 0.294656180501 30 48 0 8 0.384075206065 30 49 0 8 0.330313051366 30 75 0 8 0.264938985869 30 91 0 8 0.268473517986 31 47 0 8 0.303034500605 31 49 0 8 0.365500471429 31 54 0 8 0.454908678335 31 58 0 8 0.345493125123 32 47 0 8 0.277602397436 32 48 0 8 0.34959894129 32 49 0 8 0.313803887227 35 45 0 8 0.264204452982 35 54 0 8 0.388372657817 35 58 0 8 0.501794102889 36 62 0 8 0.391795764706 38 58 0 8 0.328569037158 39 58 0 8 0.308677459784 39 62 0 8 0.267617115108 43 69 0 8 0.314219537399 45 58 0 8 0.302095049682 45 67 0 8 0.275794942149 45 68 0 8 0.281522931308 45 69 0 8 0.377388121163 45 70 0 8 0.437787911406 45 85 0 8 0.272126406206 45 87 0 8 0.32483472747 46 58 0 8 0.284656504202 46 67 0 8 0.305394117788 46 70 0 8 0.46811197967 46 72 0 8 0.265414903324 46 85 0 8 0.424527525633 46 87 0 8 0.263348256986 47 58 0 8 0.619274931658 47 72 0 8 0.621742340456 47 90 0 8 0.306774314526 48 72 0 8 0.265971026087 48 73 0 8 0.369215714044 49 58 0 8 0.263232774623 49 72 0 8 0.361238405479 49 73 0 8 0.263512860015 49 74 0 8 0.311463850888 49 75 0 8 0.323000984109 49 78 0 8 0.263674535323 49 90 0 8 0.269886109195 49 91 0 8 0.317678772829 49 92 0 8 0.326504485106 49 93 0 8 0.373679089069 49 95 0 8 0.263713896917 49 96 0 8 0.401830527208 51 96 0 8 0.263843367284 54 92 0 8 0.435338576127 55 67 0 8 0.263442919993 55 70 0 8 0.380960882582 55 72 0 8 0.514767790081 58 70 0 8 0.273307445545 58 72 0 8 0.611796449804 62 72 0 8 0.32017080947 70 85 0 8 0.359222140036 70 86 0 8 0.273630910891 70 87 0 8 0.332952918367 70 88 0 8 0.300296088529 72 85 0 8 0.467915576874 72 87 0 8 0.39194978455 72 88 0 8 0.267014838996 72 89 0 8 0.423485675309 72 90 0 8 0.280432398305 73 89 0 8 0.344303925123 74 90 0 8 0.355671112534 76 90 0 8 0.300891946497 76 91 0 8 0.395500815417 77 90 0 8 0.332959712245 77 91 0 8 0.433124964592 77 92 0 8 0.265216468842 77 93 0 8 0.265468578225 78 91 0 8 0.267826611511 78 94 0 8 0.265614434783 78 96 0 8 0.264818949272 86 107 0 8 0.266895738552 86 111 0 8 0.268765892086 86 114 0 8 0.263449751344 88 104 0 8 0.31920335513 88 111 0 8 0.422193253388 90 117 0 8 0.263706089659 93 103 0 8 0.263349558195 93 111 0 8 0.338185426694 93 114 0 8 0.265426288909 93 115 0 8 0.494239027648 93 117 0 8 0.285093514006 93 119 0 8 0.356799052065 94 103 0 8 0.368469595601 94 111 0 8 0.296375411543 94 115 0 8 0.377546357027 94 117 0 8 0.406023708861 94 119 0 8 0.27512068595 96 111 0 8 0.289078742857 96 114 0 8 0.263908102468 96 115 0 8 0.308668809124 96 119 0 8 0.523047459919 107 117 0 8 0.287968753004 154 165 0 8 0.264414273049 END