CASP6 Target T0281
- 1. Protein Name
- 1whz
- 2. Organism Name
- Thermus thermophilus
- 3. Number of amino acids (approx)
- 70
- 4. Accession number
- 5. Sequence Database
-
6. Amino acid sequence
-
MWMPPRPEEVARKLRRLGFVERMAKGGHRLYTHPDGRIVVVPFHSGELPKGTFKRILRDA
GLTEEEFHNL
-
7. Additional information
-
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- finished
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- completed
- 12. Estimated date of public release of structure
- October 2004
Related Files
Template Sequence file
Template PDB file