CASP6 Target T0263
Received Wed Aug 4 11:57:37 PDT 2004
- 1. Protein Name
- 1wd6
- 2. Organism Name
- Escherichia coli
- 3. Number of amino acids (approx)
- 101
- 4. Accession number
- AAB47943
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
- MATLLQLHFAFNGPFGDAMAEQLKPLAESINQEPGFLWKVWTESEKNHEAGGIYLFTDEK
SALAYLEKHTARLKNLGVEEVVAKVFDVNEPLSQINQAKLA
- 7. Additional information
- GO category Molecular Function:
GO category Biological process:
GO category Cellular components:
Binding:
Binding site:
Residue role:
PT modifications:
Comment:
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- -
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- 09/01/2004
- 12. Estimated date of public release of structure
- 10/2004
Related Files
Template Sequence file
Template PDB file