PFRMAT RR TARGET T0240 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 ASGPRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPA NMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQASGPRALSRN QPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNA MRRWRYEPGKPGSGIVVNILFKINGTTEIQ 101 156 0 8 0.7786 113 142 0 8 0.70635 93 157 0 8 0.68765 94 156 0 8 0.6783 102 156 0 8 0.6698 137 156 0 8 0.6562 100 156 0 8 0.6528 101 154 0 8 0.60775 120 170 0 8 0.6035 156 169 0 8 0.5525 120 133 0 8 0.5457 101 172 0 8 0.5457 90 156 0 8 0.5457 98 156 0 8 0.51935 102 150 0 8 0.5066 156 171 0 8 0.49725 98 157 0 8 0.49215 101 162 0 8 0.459 93 156 0 8 0.459 97 156 0 8 0.45645 150 166 0 8 0.45135 132 156 0 8 0.4488 102 154 0 8 0.4318 49 111 0 8 0.42925 123 132 0 8 0.4182 148 174 0 8 0.41565 94 122 0 8 0.3859 144 177 0 8 0.3808 155 166 0 8 0.37825 150 167 0 8 0.37825 129 154 0 8 0.3655 113 140 0 8 0.3502 121 143 0 8 0.34765 129 158 0 8 0.34595 154 168 0 8 0.3383 108 142 0 8 0.3383 98 129 0 8 0.33065 81 173 0 8 0.3264 102 162 0 8 0.32385 122 168 0 8 0.3213 159 169 0 8 0.3145 137 150 0 8 0.31195 99 139 0 8 0.3094 98 134 0 8 0.3094 150 171 0 8 0.30685 120 169 0 8 0.3026 95 122 0 8 0.2975 148 175 0 8 0.29325 100 150 0 8 0.29325 144 166 0 8 0.2771 118 166 0 8 0.2686 111 171 0 8 0.2635 101 171 0 8 0.2618 93 122 0 8 0.2618 124 168 0 8 0.25925 10 123 0 8 0.2533 156 173 0 8 0.25075 129 168 0 8 0.25075 122 156 0 8 0.24905 97 121 0 8 0.2465 96 159 0 8 0.2465 100 154 0 8 0.2448 155 169 0 8 0.24225 99 168 0 8 0.24225 77 111 0 8 0.24055 97 159 0 8 0.238 4 133 0 8 0.2363 111 129 0 8 0.23205 81 171 0 8 0.23205 122 169 0 8 0.23035 159 168 0 8 0.2278 93 107 0 8 0.2278 29 69 0 8 0.2244 121 154 0 8 0.22185 101 167 0 8 0.22185 155 164 0 8 0.2142 99 169 0 8 0.2142 125 156 0 8 0.2125 119 150 0 8 0.2108 17 166 0 8 0.20145 95 139 0 8 0.1938 99 134 0 8 0.1921 40 111 0 8 0.1904 33 169 0 8 0.1904 102 167 0 8 0.1887 96 171 0 8 0.1887 155 168 0 8 0.1853 100 151 0 8 0.1836 END