CASP6 Target T0240
- 1. Protein Name
- tonb
-
2. Organism Name
- E.coli
-
3. Number of amino acids (approx)
- 92
-
4. Accession number
- P02929; P76831; P94719; P94722; P94726; P94728; P94732; P94736
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
ASGPRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNA
MRRWRYEPGKPGSGIVVNILFKINGTTEIQ
-
7. Additional information
-
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- Structure solved and refined at very high resolution (1.1 A).
The expressed part of the TonB sequence is 92 residues long,
of which residues 3-92 (those pasted under item #6) are visible/modelled in one and residues 5-92 in the other monomer of the asymmetric unit.
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- done
-
12. Estimated date of public release of structure
- after manuscript is accepted
Related Files
Template Sequence file
Template PDB file