PFRMAT RR
TARGET T0240
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximate of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
ASGPRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPA
NMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQ
12 66 0 8 0.622
12 64 0 8 0.463
31 61 0 8 0.445
12 60 0 8 0.424
18 52 0 8 0.331
23 52 0 8 0.308
10 64 0 8 0.305
31 69 0 8 0.293
31 54 0 8 0.283
53 84 0 8 0.28
15 31 0 8 0.273
7 66 0 8 0.268
30 43 0 8 0.257
44 57 0 8 0.248
6 64 0 8 0.248
12 74 0 8 0.243
32 41 0 8 0.241
29 58 0 8 0.239
61 76 0 8 0.237
53 64 0 8 0.232
29 57 0 8 0.232
7 76 0 8 0.232
31 76 0 8 0.228
57 87 0 8 0.226
69 79 0 8 0.224
61 78 0 8 0.224
69 80 0 8 0.222
15 45 0 8 0.222
10 72 0 8 0.222
6 39 0 8 0.218
12 67 0 8 0.216
60 74 0 8 0.214
53 76 0 8 0.212
49 69 0 8 0.212
45 76 0 8 0.212
10 84 0 8 0.212
9 66 0 8 0.212
60 78 0 8 0.21
19 83 0 8 0.21
69 78 0 8 0.208
66 76 0 8 0.208
64 76 0 8 0.208
44 53 0 8 0.208
23 76 0 8 0.208
46 84 0 8 0.206
END