CASP6 Target T0231
-
1. Protein Name
- glia maturation factor gamma
-
2. Organism Name
- mouse
-
3. Number of amino acids (approx)
- 142
-
4. Accession number
- AAG22804
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
MSDSLVVCEVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQNISPEELKLE
LPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKV
FEIRTTDDLTETWLKEKLAFFR
-
7. Additional information
-
JCSG target 15079298
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- solved, refined, structure in internal quality control
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- done
-
12. Estimated date of public release of structure
- after September 1
Related Files
Template Sequence file
Template PDB file