PFRMAT RR TARGET T0231 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length REMARK or to a limited set of high scoring pairs. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MSDSLVVCEVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQ NISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQ QMMYAGSKNRLVQTAELTKVFEIRTTDDLTETWLKEKLAFFR 30 101 0 8 0.6562 31 69 0 8 0.62985 31 102 0 8 0.59925 21 69 0 8 0.5865 30 102 0 8 0.57715 18 69 0 8 0.56865 99 110 0 8 0.56185 91 123 0 8 0.5593 98 107 0 8 0.53805 14 32 0 8 0.5219 14 31 0 8 0.5117 7 107 0 8 0.50405 69 91 0 8 0.50235 14 91 0 8 0.4947 32 70 0 8 0.49215 61 90 0 8 0.4794 21 84 0 8 0.47685 8 69 0 8 0.47685 18 66 0 8 0.4743 14 70 0 8 0.4692 57 69 0 8 0.46665 71 88 0 8 0.459 18 57 0 8 0.45645 69 107 0 8 0.4539 32 88 0 8 0.45135 7 101 0 8 0.45135 99 114 0 8 0.44625 8 101 0 8 0.4437 98 110 0 8 0.4369 10 69 0 8 0.4369 34 90 0 8 0.42925 18 88 0 8 0.42925 14 34 0 8 0.4267 41 98 0 8 0.4233 8 66 0 8 0.4233 8 107 0 8 0.40885 101 115 0 8 0.4012 21 85 0 8 0.39865 8 102 0 8 0.39865 21 86 0 8 0.39355 96 107 0 8 0.391 8 18 0 8 0.391 8 106 0 8 0.3859 8 91 0 8 0.3859 14 69 0 8 0.3808 30 69 0 8 0.37825 86 123 0 8 0.37315 34 134 0 8 0.37315 101 124 0 8 0.3655 7 112 0 8 0.3655 7 106 0 8 0.3655 91 107 0 8 0.36295 18 34 0 8 0.36295 85 115 0 8 0.35275 72 115 0 8 0.35275 66 90 0 8 0.35275 41 100 0 8 0.3502 34 69 0 8 0.3502 14 92 0 8 0.3502 8 96 0 8 0.3502 69 115 0 8 0.3434 45 67 0 8 0.3434 41 99 0 8 0.3434 14 90 0 8 0.3434 8 71 0 8 0.3434 41 120 0 8 0.34085 18 32 0 8 0.34085 120 140 0 8 0.33065 92 107 0 8 0.3162 34 45 0 8 0.3162 18 115 0 8 0.3162 18 45 0 8 0.3162 100 109 0 8 0.2907 18 96 0 8 0.28645 75 86 0 8 0.2839 33 75 0 8 0.2839 18 91 0 8 0.2839 15 92 0 8 0.2839 41 106 0 8 0.28135 8 90 0 8 0.28135 61 91 0 8 0.27965 45 71 0 8 0.27965 8 30 0 8 0.27965 94 124 0 8 0.2771 92 101 0 8 0.27455 7 18 0 8 0.27455 1 107 0 8 0.27285 30 54 0 8 0.2686 33 107 0 8 0.26605 17 45 0 8 0.26605 8 21 0 8 0.2635 30 98 0 8 0.2618 8 72 0 8 0.2618 7 99 0 8 0.25755 14 66 0 8 0.255 10 67 0 8 0.255 54 72 0 8 0.2533 7 98 0 8 0.2533 73 86 0 8 0.25075 66 75 0 8 0.25075 41 107 0 8 0.25075 112 122 0 8 0.2465 45 75 0 8 0.2465 7 102 0 8 0.24225 10 92 0 8 0.24055 8 110 0 8 0.24055 41 70 0 8 0.2363 14 107 0 8 0.2363 70 137 0 8 0.2346 7 30 0 8 0.2346 100 124 0 8 0.23035 14 61 0 8 0.23035 88 117 0 8 0.2261 7 69 0 8 0.2261 87 103 0 8 0.22185 7 113 0 8 0.22185 99 115 0 8 0.22015 18 85 0 8 0.22015 1 33 0 8 0.21845 21 31 0 8 0.21675 8 41 0 8 0.21675 108 117 0 8 0.2142 72 96 0 8 0.2142 8 57 0 8 0.2142 21 73 0 8 0.2125 21 57 0 8 0.2125 88 104 0 8 0.2091 86 107 0 8 0.2091 10 107 0 8 0.2091 69 93 0 8 0.20655 31 103 0 8 0.20655 30 107 0 8 0.20485 21 36 0 8 0.20485 7 110 0 8 0.20315 96 110 0 8 0.20145 57 75 0 8 0.19975 7 94 0 8 0.19975 85 117 0 8 0.1955 66 107 0 8 0.1955 96 106 0 8 0.1938 72 92 0 8 0.1921 41 101 0 8 0.1921 90 108 0 8 0.1904 75 107 0 8 0.1904 75 91 0 8 0.1904 31 73 0 8 0.1887 86 114 0 8 0.187 10 35 0 8 0.187 72 85 0 8 0.1853 17 60 0 8 0.1853 101 116 0 8 0.1836 96 116 0 8 0.1836 72 122 0 8 0.1836 7 96 0 8 0.1836 72 107 0 8 0.1819 57 122 0 8 0.1819 7 124 0 8 0.1819 69 106 0 8 0.1802 94 116 0 8 0.1785 90 107 0 8 0.1768 41 122 0 8 0.1768 14 86 0 8 0.1768 34 117 0 8 0.1751 31 72 0 8 0.1751 58 110 0 8 0.1734 45 58 0 8 0.1734 45 100 0 8 0.1717 8 92 0 8 0.17 END