PFRMAT RR
TARGET T0231
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximate of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MSDSLVVCEVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQ
NISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQ
QMMYAGSKNRLVQTAELTKVFEIRTTDDLTETWLKEKLAFFR
14 32 0 8 0.381
101 124 0 8 0.375
71 88 0 8 0.361
90 120 0 8 0.356
14 91 0 8 0.356
21 85 0 8 0.353
7 107 0 8 0.353
7 101 0 8 0.35
92 107 0 8 0.347
30 101 0 8 0.337
8 69 0 8 0.334
69 91 0 8 0.331
87 103 0 8 0.329
14 70 0 8 0.318
69 85 0 8 0.313
31 69 0 8 0.298
92 101 0 8 0.293
85 115 0 8 0.293
10 34 0 8 0.293
8 107 0 8 0.293
96 107 0 8 0.288
34 69 0 8 0.285
91 123 0 8 0.283
7 99 0 8 0.283
34 90 0 8 0.28
21 86 0 8 0.28
96 116 0 8 0.278
41 90 0 8 0.278
21 69 0 8 0.276
18 115 0 8 0.276
18 88 0 8 0.276
7 113 0 8 0.276
7 106 0 8 0.276
69 107 0 8 0.273
41 70 0 8 0.273
41 120 0 8 0.266
34 122 0 8 0.266
30 102 0 8 0.264
7 94 0 8 0.264
7 124 0 8 0.261
88 104 0 8 0.259
53 105 0 8 0.257
10 67 0 8 0.257
101 120 0 8 0.255
32 88 0 8 0.255
112 122 0 8 0.25
99 124 0 8 0.25
69 122 0 8 0.25
69 94 0 8 0.25
67 86 0 8 0.25
57 122 0 8 0.25
1 91 0 8 0.25
18 69 0 8 0.248
18 66 0 8 0.248
8 66 0 8 0.248
69 115 0 8 0.246
14 31 0 8 0.246
41 106 0 8 0.243
31 102 0 8 0.243
30 69 0 8 0.243
68 101 0 8 0.241
21 122 0 8 0.241
100 124 0 8 0.239
8 90 0 8 0.237
90 101 0 8 0.235
72 83 0 8 0.235
70 101 0 8 0.235
41 99 0 8 0.235
32 70 0 8 0.235
18 101 0 8 0.235
8 99 0 8 0.235
END