PFRMAT RR
TARGET T0230
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MPMSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMT
MTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELRE
KFGV
35 49 0 8 0.585
33 49 0 8 0.412
35 93 0 8 0.345
35 50 0 8 0.339
50 87 0 8 0.337
33 85 0 8 0.334
35 59 0 8 0.318
35 85 0 8 0.316
33 53 0 8 0.305
53 85 0 8 0.303
33 84 0 8 0.298
33 93 0 8 0.293
33 89 0 8 0.293
89 102 0 8 0.288
54 85 0 8 0.288
33 58 0 8 0.288
25 58 0 8 0.283
50 89 0 8 0.28
25 52 0 8 0.28
47 66 0 8 0.276
50 85 0 8 0.271
49 85 0 8 0.271
33 59 0 8 0.271
59 93 0 8 0.264
33 52 0 8 0.261
52 87 0 8 0.259
50 84 0 8 0.259
27 51 0 8 0.259
36 47 0 8 0.257
19 62 0 8 0.255
51 85 0 8 0.246
52 89 0 8 0.241
23 58 0 8 0.241
33 91 0 8 0.237
33 62 0 8 0.237
25 53 0 8 0.224
24 58 0 8 0.224
87 102 0 8 0.22
33 83 0 8 0.218
91 102 0 8 0.216
27 93 0 8 0.216
33 51 0 8 0.214
33 50 0 8 0.214
20 53 0 8 0.212
89 99 0 8 0.21
50 59 0 8 0.21
49 93 0 8 0.21
25 55 0 8 0.21
46 74 0 8 0.208
54 93 0 8 0.206
13 30 0 8 0.206
35 53 0 8 0.204
END