PFRMAT RR
TARGET T0225
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximate of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MKILITGANGQLGREIQKQLKGKNVEVIPTDVQDLDITNVLAVNKFFNEK
KPNVVINCAAHTAVDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQIS
TDYVFDGEAKEPITEFDEVNPQSAYGKTKLEGENFVKALNPKYYIVRTAW
LYGDGNNFVKTMINLGKTHDELKVVHDQVGTPTSTVDLARVVLKVIDEKN
YGTFHCTCKGICSWYDFAVEIFRLTGIDVKVTPCTTEEFPRPAKRPKYSV
LRNYMLELTTGDITREWKESLKEYIDLLQM
180 214 0 8 0.669
6 57 0 8 0.669
105 205 0 8 0.663
102 182 0 8 0.663
11 153 0 8 0.663
214 245 0 8 0.658
150 180 0 8 0.658
57 82 0 8 0.655
182 214 0 8 0.653
113 182 0 8 0.653
106 182 0 8 0.647
182 245 0 8 0.644
181 209 0 8 0.644
184 270 0 8 0.642
113 214 0 8 0.642
11 150 0 8 0.642
11 103 0 8 0.642
150 182 0 8 0.639
150 174 0 8 0.639
65 103 0 8 0.639
11 185 0 8 0.639
174 214 0 8 0.636
158 214 0 8 0.636
150 214 0 8 0.636
68 245 0 8 0.636
182 246 0 8 0.633
191 206 0 8 0.63
173 214 0 8 0.63
150 175 0 8 0.63
133 147 0 8 0.63
103 214 0 8 0.63
214 251 0 8 0.628
158 182 0 8 0.628
148 245 0 8 0.628
86 182 0 8 0.628
11 180 0 8 0.628
182 249 0 8 0.625
105 214 0 8 0.625
102 245 0 8 0.625
102 214 0 8 0.625
86 245 0 8 0.625
68 182 0 8 0.625
176 214 0 8 0.622
148 182 0 8 0.622
107 214 0 8 0.622
103 182 0 8 0.622
86 150 0 8 0.622
11 182 0 8 0.622
175 214 0 8 0.619
105 182 0 8 0.619
104 133 0 8 0.619
102 148 0 8 0.619
68 150 0 8 0.619
65 102 0 8 0.619
58 148 0 8 0.619
11 151 0 8 0.619
180 267 0 8 0.616
150 267 0 8 0.616
107 148 0 8 0.616
105 215 0 8 0.616
105 150 0 8 0.616
99 192 0 8 0.616
62 103 0 8 0.616
61 249 0 8 0.616
11 214 0 8 0.616
182 251 0 8 0.614
173 182 0 8 0.614
106 214 0 8 0.614
150 181 0 8 0.611
150 160 0 8 0.611
141 182 0 8 0.611
107 182 0 8 0.611
103 205 0 8 0.611
102 251 0 8 0.611
86 148 0 8 0.611
148 214 0 8 0.608
106 245 0 8 0.608
74 245 0 8 0.608
67 214 0 8 0.608
64 214 0 8 0.608
182 267 0 8 0.605
178 214 0 8 0.605
150 249 0 8 0.605
78 128 0 8 0.605
68 214 0 8 0.605
65 182 0 8 0.605
8 29 0 8 0.605
147 203 0 8 0.602
65 214 0 8 0.602
62 214 0 8 0.602
185 214 0 8 0.599
182 208 0 8 0.599
182 205 0 8 0.599
113 245 0 8 0.599
113 150 0 8 0.599
107 150 0 8 0.599
68 149 0 8 0.599
65 149 0 8 0.599
61 180 0 8 0.599
19 193 0 8 0.599
214 248 0 8 0.596
177 214 0 8 0.596
150 176 0 8 0.596
150 173 0 8 0.596
148 215 0 8 0.596
126 214 0 8 0.596
112 150 0 8 0.596
105 180 0 8 0.596
102 249 0 8 0.596
86 106 0 8 0.596
78 125 0 8 0.596
181 214 0 8 0.593
148 173 0 8 0.593
65 148 0 8 0.593
15 182 0 8 0.593
11 148 0 8 0.593
214 267 0 8 0.591
182 215 0 8 0.591
181 205 0 8 0.591
180 249 0 8 0.591
176 215 0 8 0.591
149 182 0 8 0.591
98 132 0 8 0.591
74 249 0 8 0.591
65 150 0 8 0.591
62 180 0 8 0.591
61 150 0 8 0.591
149 251 0 8 0.588
105 175 0 8 0.588
102 246 0 8 0.588
15 185 0 8 0.588
215 245 0 8 0.585
180 205 0 8 0.585
153 185 0 8 0.585
150 205 0 8 0.585
214 250 0 8 0.582
173 245 0 8 0.582
148 185 0 8 0.582
113 215 0 8 0.582
106 150 0 8 0.582
END