PFRMAT RR TARGET T0219 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artificial neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MSAVTESVLESIISPVTMSEFLEEYWPVKPLVARGEVERFTSIPGFEKVR TLENVLAIYNNPVMVVGDAVIEESEGITDRFLVSPAEALEWYEKGAALEF DFTDLFIPQVRRWIEKLKAELRLPAGTSSKAIVYAAKNGGGFKAHFDAYT NLIFQIQGEKTWKLAKNENVSNPMQHYDLSEAPYYPDDLQSYWKGDPPKE DLPDAEIVNLTPGTMLYLPRGLWHSTKSDQATLALNITFGQPAWLDLMLA ALRKKLISDNRFRELAVNHQSLHESSKSELNGYLESLIQTLSENAETLTP EQIFQSQDSDFDPYQSTQLVFRQLLTSYKF 155 238 0 8 0.591 151 238 0 8 0.561 155 237 0 8 0.558 226 238 0 8 0.531 155 210 0 8 0.525 151 236 0 8 0.522 134 225 0 8 0.522 153 238 0 8 0.519 155 216 0 8 0.508 136 155 0 8 0.502 153 223 0 8 0.498 153 210 0 8 0.492 153 240 0 8 0.486 142 226 0 8 0.486 141 153 0 8 0.486 237 249 0 8 0.483 155 228 0 8 0.483 155 223 0 8 0.481 136 153 0 8 0.481 134 153 0 8 0.481 237 248 0 8 0.475 153 237 0 8 0.475 132 225 0 8 0.475 163 238 0 8 0.463 134 238 0 8 0.463 162 248 0 8 0.46 152 219 0 8 0.457 134 155 0 8 0.457 129 248 0 8 0.457 167 222 0 8 0.454 152 245 0 8 0.454 142 238 0 8 0.454 136 222 0 8 0.451 225 248 0 8 0.448 153 228 0 8 0.448 144 237 0 8 0.448 144 226 0 8 0.448 141 237 0 8 0.448 136 228 0 8 0.448 132 237 0 8 0.448 132 148 0 8 0.445 225 244 0 8 0.442 151 237 0 8 0.442 147 236 0 8 0.442 144 248 0 8 0.442 141 155 0 8 0.442 225 237 0 8 0.439 136 236 0 8 0.439 210 237 0 8 0.436 226 235 0 8 0.433 219 246 0 8 0.43 155 234 0 8 0.43 152 237 0 8 0.427 136 238 0 8 0.427 132 141 0 8 0.424 204 244 0 8 0.421 154 237 0 8 0.421 152 236 0 8 0.421 141 236 0 8 0.421 215 248 0 8 0.418 151 234 0 8 0.418 142 234 0 8 0.418 136 147 0 8 0.418 132 244 0 8 0.418 85 153 0 8 0.418 151 216 0 8 0.415 147 156 0 8 0.415 157 237 0 8 0.412 155 235 0 8 0.412 141 235 0 8 0.412 136 219 0 8 0.412 134 237 0 8 0.412 134 162 0 8 0.412 132 165 0 8 0.412 155 240 0 8 0.409 155 236 0 8 0.409 148 244 0 8 0.407 141 225 0 8 0.407 134 151 0 8 0.407 225 236 0 8 0.404 157 248 0 8 0.404 154 238 0 8 0.404 147 164 0 8 0.404 155 225 0 8 0.401 136 227 0 8 0.401 134 152 0 8 0.401 132 234 0 8 0.401 151 225 0 8 0.398 151 210 0 8 0.398 147 219 0 8 0.395 136 225 0 8 0.395 132 227 0 8 0.395 228 238 0 8 0.392 153 163 0 8 0.392 148 246 0 8 0.392 136 226 0 8 0.392 136 160 0 8 0.392 134 210 0 8 0.392 132 228 0 8 0.392 132 142 0 8 0.392 228 240 0 8 0.389 155 215 0 8 0.389 144 227 0 8 0.389 134 236 0 8 0.389 132 143 0 8 0.389 156 219 0 8 0.386 151 228 0 8 0.384 136 223 0 8 0.384 131 237 0 8 0.384 223 236 0 8 0.381 156 225 0 8 0.381 153 216 0 8 0.381 140 153 0 8 0.381 136 240 0 8 0.381 134 144 0 8 0.381 132 226 0 8 0.381 235 244 0 8 0.378 218 237 0 8 0.378 217 248 0 8 0.378 151 217 0 8 0.378 132 144 0 8 0.378 156 222 0 8 0.375 153 172 0 8 0.375 144 225 0 8 0.375 141 228 0 8 0.375 134 226 0 8 0.375 134 215 0 8 0.375 131 148 0 8 0.375 218 248 0 8 0.372 155 248 0 8 0.372 151 226 0 8 0.372 148 225 0 8 0.372 144 234 0 8 0.372 151 239 0 8 0.37 147 225 0 8 0.37 147 222 0 8 0.37 142 240 0 8 0.37 132 238 0 8 0.37 131 236 0 8 0.37 131 155 0 8 0.37 236 248 0 8 0.367 223 238 0 8 0.367 154 228 0 8 0.367 148 236 0 8 0.367 136 234 0 8 0.367 134 223 0 8 0.367 216 235 0 8 0.364 147 237 0 8 0.364 147 165 0 8 0.364 144 235 0 8 0.364 143 226 0 8 0.364 142 236 0 8 0.364 142 225 0 8 0.364 132 221 0 8 0.364 225 239 0 8 0.361 210 225 0 8 0.361 157 210 0 8 0.361 141 216 0 8 0.361 141 151 0 8 0.361 133 244 0 8 0.361 220 238 0 8 0.358 154 236 0 8 0.358 154 234 0 8 0.358 153 162 0 8 0.358 147 160 0 8 0.358 END