PFRMAT RR TARGET T0218 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MQVRIERAERIESELEEHVGDQTFVEESRFLEEDEQREGEILDQIIFVDG KRRSFVRITTDEGITGIFAELCVGAVIWDREGGTKTLFSPDKPPVKERVL GFSQSFQEEGYEEVGGILFKVVKEGKDAMQSIDLYMRSLEIEEVRKHMDK NILIVKDGPAARELPFEENVGPIGLVKNIGVTELSKEDFKKLRFLKKGKR SKMFVSSRETPLKKVGAYVKLIDGEGIRGLVRLETYVKDDNQIPYIRKVF DDLAKTLPHLTADLPIPRLPENILPIQFLEENLSYYLTDKNYMNTRLFAY IGR 52 237 0 8 0.38845 67 203 0 8 0.3655 132 203 0 8 0.36295 67 132 0 8 0.3604 119 287 0 8 0.34765 189 203 0 8 0.3213 237 287 0 8 0.27455 67 189 0 8 0.2618 132 189 0 8 0.25925 24 212 0 8 0.2533 66 119 0 8 0.2278 60 132 0 8 0.2125 66 287 0 8 0.1887 END