PFRMAT RR TARGET T0218 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artificial neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MQVRIERAERIESELEEHVGDQTFVEESRFLEEDEQREGEILDQIIFVDG KRRSFVRITTDEGITGIFAELCVGAVIWDREGGTKTLFSPDKPPVKERVL GFSQSFQEEGYEEVGGILFKVVKEGKDAMQSIDLYMRSLEIEEVRKHMDK NILIVKDGPAARELPFEENVGPIGLVKNIGVTELSKEDFKKLRFLKKGKR SKMFVSSRETPLKKVGAYVKLIDGEGIRGLVRLETYVKDDNQIPYIRKVF DDLAKTLPHLTADLPIPRLPENILPIQFLEENLSYYLTDKNYMNTRLFAY IGR 67 132 0 8 0.305 67 203 0 8 0.295 67 189 0 8 0.285 70 211 0 8 0.28 2 70 0 8 0.273 132 203 0 8 0.268 132 189 0 8 0.266 189 203 0 8 0.248 52 237 0 8 0.243 27 67 0 8 0.241 21 67 0 8 0.237 116 145 0 8 0.232 126 237 0 8 0.23 27 189 0 8 0.23 71 236 0 8 0.22 54 180 0 8 0.22 116 224 0 8 0.216 145 224 0 8 0.214 96 179 0 8 0.214 59 180 0 8 0.214 54 133 0 8 0.214 27 203 0 8 0.214 6 116 0 8 0.214 2 211 0 8 0.214 105 172 0 8 0.212 25 129 0 8 0.212 133 180 0 8 0.21 127 179 0 8 0.21 72 197 0 8 0.21 60 203 0 8 0.21 60 189 0 8 0.21 59 133 0 8 0.208 54 150 0 8 0.208 21 203 0 8 0.208 113 145 0 8 0.206 133 150 0 8 0.204 60 132 0 8 0.204 29 154 0 8 0.204 22 154 0 8 0.204 162 228 0 8 0.202 46 249 0 8 0.202 96 127 0 8 0.2 72 118 0 8 0.2 52 126 0 8 0.2 27 132 0 8 0.2 21 132 0 8 0.2 178 249 0 8 0.198 113 224 0 8 0.198 83 105 0 8 0.198 72 109 0 8 0.198 21 189 0 8 0.198 6 224 0 8 0.198 59 150 0 8 0.196 150 180 0 8 0.194 70 301 0 8 0.194 63 163 0 8 0.194 6 145 0 8 0.194 66 119 0 8 0.192 27 60 0 8 0.191 138 241 0 8 0.189 71 294 0 8 0.189 21 60 0 8 0.187 6 113 0 8 0.187 62 241 0 8 0.185 62 138 0 8 0.185 71 165 0 8 0.183 181 249 0 8 0.178 118 197 0 8 0.178 70 263 0 8 0.178 67 89 0 8 0.178 213 231 0 8 0.176 83 172 0 8 0.176 178 293 0 8 0.174 46 293 0 8 0.174 23 231 0 8 0.174 52 248 0 8 0.173 43 70 0 8 0.173 38 52 0 8 0.173 119 287 0 8 0.171 119 225 0 8 0.171 109 197 0 8 0.171 116 253 0 8 0.169 72 289 0 8 0.169 46 284 0 8 0.169 13 66 0 8 0.169 52 119 0 8 0.168 168 249 0 8 0.166 107 214 0 8 0.166 67 288 0 8 0.166 66 169 0 8 0.166 62 72 0 8 0.166 54 118 0 8 0.166 253 265 0 8 0.164 224 265 0 8 0.163 119 248 0 8 0.163 65 116 0 8 0.163 52 287 0 8 0.163 119 237 0 8 0.161 78 89 0 8 0.161 70 156 0 8 0.161 38 214 0 8 0.161 224 253 0 8 0.159 118 180 0 8 0.159 67 285 0 8 0.159 64 165 0 8 0.159 59 118 0 8 0.159 43 214 0 8 0.159 10 151 0 8 0.159 249 293 0 8 0.158 249 284 0 8 0.158 210 225 0 8 0.158 178 284 0 8 0.158 113 253 0 8 0.158 66 248 0 8 0.158 62 197 0 8 0.158 46 255 0 8 0.158 119 169 0 8 0.156 66 210 0 8 0.156 59 163 0 8 0.156 52 210 0 8 0.156 39 116 0 8 0.155 25 249 0 8 0.155 13 119 0 8 0.155 197 289 0 8 0.153 172 236 0 8 0.153 125 160 0 8 0.153 84 243 0 8 0.153 60 89 0 8 0.153 25 151 0 8 0.153 6 253 0 8 0.153 2 214 0 8 0.153 202 288 0 8 0.152 159 225 0 8 0.152 151 206 0 8 0.152 65 253 0 8 0.152 34 119 0 8 0.152 25 293 0 8 0.152 24 212 0 8 0.152 237 287 0 8 0.15 206 255 0 8 0.15 156 211 0 8 0.15 142 151 0 8 0.15 130 165 0 8 0.15 129 249 0 8 0.15 126 287 0 8 0.15 124 301 0 8 0.15 124 155 0 8 0.15 109 241 0 8 0.15 83 236 0 8 0.15 66 287 0 8 0.15 54 289 0 8 0.15 END