PFRMAT RR TARGET T0217 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artificial neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MVYVGTSGFSFEDWKGVVYPEHLKPSQFLKYYWAVLGFRIVELNFTYYTQ PSWRSFVQMLRKTPPDFYFTVKTPGSVTHVLWKEGKDPKEDMENFTRQIE PLIEEQRLKMTLAQFPFSFKFSRKNVEYLEKLRESYPYELAVEFRHYSWD REETYEFLRNHGITFVVVDEPKLPGLFPYRPITTTDYAYFRFHGRNERWF EAEGEERYDYLYSEEELKTLFEDVVELSRRVKETYVFFNNCYKGQAAINA LQFKKMLEERV 8 189 0 8 0.448 144 154 0 8 0.415 238 249 0 8 0.409 193 238 0 8 0.409 193 249 0 8 0.401 70 189 0 8 0.384 71 193 0 8 0.364 32 113 0 8 0.339 7 239 0 8 0.318 2 43 0 8 0.31 7 165 0 8 0.308 193 239 0 8 0.305 7 241 0 8 0.305 7 237 0 8 0.303 189 241 0 8 0.293 110 141 0 8 0.29 125 210 0 8 0.288 7 189 0 8 0.288 144 227 0 8 0.285 7 70 0 8 0.283 70 237 0 8 0.28 43 239 0 8 0.28 43 193 0 8 0.28 165 241 0 8 0.278 73 113 0 8 0.278 43 70 0 8 0.278 8 43 0 8 0.278 166 236 0 8 0.276 71 246 0 8 0.276 40 115 0 8 0.276 8 70 0 8 0.276 7 249 0 8 0.276 11 241 0 8 0.273 7 242 0 8 0.273 4 250 0 8 0.273 113 239 0 8 0.271 11 75 0 8 0.271 112 246 0 8 0.268 165 239 0 8 0.266 99 144 0 8 0.266 70 241 0 8 0.266 28 140 0 8 0.266 216 239 0 8 0.264 193 241 0 8 0.264 239 249 0 8 0.261 79 241 0 8 0.261 8 112 0 8 0.261 28 183 0 8 0.259 210 249 0 8 0.257 112 239 0 8 0.257 43 240 0 8 0.257 168 242 0 8 0.255 168 239 0 8 0.255 167 243 0 8 0.255 144 196 0 8 0.255 170 242 0 8 0.252 166 237 0 8 0.252 70 192 0 8 0.252 6 189 0 8 0.252 167 190 0 8 0.25 112 189 0 8 0.25 73 239 0 8 0.25 43 241 0 8 0.25 43 189 0 8 0.25 40 237 0 8 0.25 32 140 0 8 0.25 6 239 0 8 0.248 6 113 0 8 0.248 6 70 0 8 0.248 195 216 0 8 0.246 189 237 0 8 0.246 140 243 0 8 0.246 7 193 0 8 0.246 7 168 0 8 0.246 170 241 0 8 0.243 168 249 0 8 0.243 168 188 0 8 0.243 112 241 0 8 0.243 11 165 0 8 0.243 170 183 0 8 0.241 6 140 0 8 0.241 196 241 0 8 0.239 165 196 0 8 0.239 98 243 0 8 0.239 43 73 0 8 0.239 6 249 0 8 0.239 210 239 0 8 0.237 129 140 0 8 0.237 111 190 0 8 0.237 80 241 0 8 0.237 44 70 0 8 0.237 235 249 0 8 0.235 189 235 0 8 0.235 165 242 0 8 0.235 113 140 0 8 0.235 7 44 0 8 0.235 6 168 0 8 0.235 168 196 0 8 0.232 70 79 0 8 0.232 55 115 0 8 0.232 43 110 0 8 0.232 8 239 0 8 0.232 6 79 0 8 0.232 44 237 0 8 0.23 44 85 0 8 0.23 8 164 0 8 0.23 7 112 0 8 0.23 139 234 0 8 0.228 74 247 0 8 0.228 44 146 0 8 0.228 112 249 0 8 0.226 170 247 0 8 0.224 112 193 0 8 0.224 73 193 0 8 0.224 44 241 0 8 0.224 196 210 0 8 0.222 193 240 0 8 0.222 193 210 0 8 0.222 171 242 0 8 0.222 110 187 0 8 0.222 43 112 0 8 0.222 7 154 0 8 0.222 6 241 0 8 0.222 196 207 0 8 0.22 192 242 0 8 0.22 167 182 0 8 0.22 125 239 0 8 0.22 115 209 0 8 0.22 75 164 0 8 0.22 43 141 0 8 0.22 END