PFRMAT RR TARGET T0216 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artificial neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MTFEEFKDRLFALAKKNGVEVQISFLETREFSLRLANGDLDQYTDAGKFN VEIKVLKDGKTGTFRTQVLENPEKCFEEALSNLQVKDSEEKEYFFEGGKE YREMETYVGRFEKLSVKEKMDMAKKAHESAAKDERVVMVPTVMYKDMVIK KIITNTLGLDVESQMDGGFLFAMAIARDANPRSGSWYELARTPEDLNPEE IGKRAAEEAISLIGSKTIPSGKYPVLMRNTALLDLMEMFIPMISAENVQK NLSPLKGKLGEQVGNPAVSIKDLPYHPKGLSSTPFDDEGVPTTEKFVLEN GVLKTFLHNLKTARKEGVEPTGNGFVGGIRPVNLMLMPGEKSFEELLKEM DRGVVITEVEGMHAGANSISGEFSLFAKGYWVENGEIAHGVEDITISGNF LDLLRKIVLVGNDVKVSQHTIAPSVLVEVLDVAGK 236 330 0 8 0.653 237 330 0 8 0.63 236 331 0 8 0.614 241 331 0 8 0.608 241 330 0 8 0.608 237 246 0 8 0.608 244 331 0 8 0.602 236 421 0 8 0.602 240 330 0 8 0.591 236 246 0 8 0.588 361 377 0 8 0.585 236 334 0 8 0.582 350 382 0 8 0.579 361 399 0 8 0.576 241 375 0 8 0.573 241 421 0 8 0.57 374 400 0 8 0.567 374 397 0 8 0.564 244 330 0 8 0.561 361 395 0 8 0.546 22 54 0 8 0.543 54 238 0 8 0.534 360 395 0 8 0.531 361 374 0 8 0.522 240 375 0 8 0.522 24 54 0 8 0.522 244 421 0 8 0.519 237 331 0 8 0.519 236 375 0 8 0.519 377 399 0 8 0.517 361 398 0 8 0.514 247 374 0 8 0.514 244 375 0 8 0.514 238 375 0 8 0.508 372 399 0 8 0.505 240 331 0 8 0.505 246 375 0 8 0.502 366 375 0 8 0.498 362 375 0 8 0.498 331 421 0 8 0.495 215 246 0 8 0.495 233 330 0 8 0.492 374 396 0 8 0.486 24 246 0 8 0.483 283 292 0 8 0.481 234 325 0 8 0.481 231 329 0 8 0.481 378 395 0 8 0.478 360 375 0 8 0.478 236 247 0 8 0.475 236 325 0 8 0.472 24 151 0 8 0.472 360 374 0 8 0.469 238 366 0 8 0.469 236 378 0 8 0.466 231 374 0 8 0.466 361 370 0 8 0.463 24 63 0 8 0.463 241 378 0 8 0.46 360 378 0 8 0.457 236 400 0 8 0.457 34 361 0 8 0.457 334 378 0 8 0.454 244 325 0 8 0.454 238 362 0 8 0.454 234 244 0 8 0.454 330 375 0 8 0.451 325 378 0 8 0.451 240 421 0 8 0.448 234 375 0 8 0.448 244 400 0 8 0.445 246 331 0 8 0.442 246 330 0 8 0.442 236 328 0 8 0.442 212 393 0 8 0.442 374 394 0 8 0.439 353 382 0 8 0.436 285 400 0 8 0.433 275 400 0 8 0.433 238 331 0 8 0.433 331 375 0 8 0.43 233 375 0 8 0.43 376 394 0 8 0.427 375 421 0 8 0.427 361 375 0 8 0.427 330 421 0 8 0.427 285 374 0 8 0.427 234 331 0 8 0.427 175 236 0 8 0.427 24 50 0 8 0.427 378 421 0 8 0.424 331 422 0 8 0.424 250 361 0 8 0.424 241 400 0 8 0.424 240 334 0 8 0.424 334 421 0 8 0.421 237 334 0 8 0.421 215 240 0 8 0.421 24 244 0 8 0.421 357 378 0 8 0.418 325 366 0 8 0.418 325 334 0 8 0.418 250 377 0 8 0.418 241 422 0 8 0.418 192 236 0 8 0.418 52 326 0 8 0.418 247 400 0 8 0.415 244 334 0 8 0.415 238 264 0 8 0.415 233 396 0 8 0.415 54 63 0 8 0.415 24 236 0 8 0.415 371 400 0 8 0.412 356 374 0 8 0.412 270 334 0 8 0.412 241 334 0 8 0.412 234 330 0 8 0.412 233 334 0 8 0.412 175 361 0 8 0.412 175 215 0 8 0.412 244 360 0 8 0.409 241 325 0 8 0.409 237 375 0 8 0.409 234 421 0 8 0.409 283 325 0 8 0.407 246 362 0 8 0.407 239 400 0 8 0.407 234 397 0 8 0.407 375 400 0 8 0.404 334 422 0 8 0.404 334 400 0 8 0.404 237 421 0 8 0.404 231 400 0 8 0.404 54 375 0 8 0.404 24 331 0 8 0.404 377 394 0 8 0.401 376 395 0 8 0.401 359 374 0 8 0.401 244 374 0 8 0.401 237 422 0 8 0.401 236 374 0 8 0.401 231 396 0 8 0.401 231 244 0 8 0.401 240 357 0 8 0.398 234 334 0 8 0.398 63 241 0 8 0.398 325 375 0 8 0.395 306 373 0 8 0.395 34 395 0 8 0.395 374 399 0 8 0.392 334 357 0 8 0.392 236 422 0 8 0.392 212 241 0 8 0.392 331 378 0 8 0.389 310 330 0 8 0.389 246 334 0 8 0.389 34 399 0 8 0.389 361 397 0 8 0.386 361 396 0 8 0.386 244 283 0 8 0.386 236 368 0 8 0.386 361 371 0 8 0.384 330 400 0 8 0.384 244 422 0 8 0.384 238 250 0 8 0.384 22 361 0 8 0.384 334 396 0 8 0.381 255 361 0 8 0.381 236 362 0 8 0.381 215 236 0 8 0.381 127 358 0 8 0.381 24 238 0 8 0.381 286 329 0 8 0.378 242 358 0 8 0.378 240 325 0 8 0.378 236 335 0 8 0.378 192 241 0 8 0.378 377 400 0 8 0.375 377 397 0 8 0.375 330 422 0 8 0.375 272 396 0 8 0.375 263 396 0 8 0.375 240 400 0 8 0.375 239 375 0 8 0.375 238 254 0 8 0.375 233 422 0 8 0.375 163 330 0 8 0.375 159 325 0 8 0.375 373 398 0 8 0.372 366 395 0 8 0.372 360 376 0 8 0.372 283 374 0 8 0.372 246 325 0 8 0.372 244 328 0 8 0.372 238 334 0 8 0.372 24 237 0 8 0.372 373 397 0 8 0.37 359 372 0 8 0.37 236 283 0 8 0.37 227 360 0 8 0.37 61 375 0 8 0.37 32 143 0 8 0.37 371 399 0 8 0.367 334 360 0 8 0.367 295 323 0 8 0.367 246 421 0 8 0.367 238 422 0 8 0.367 233 331 0 8 0.367 232 329 0 8 0.367 232 244 0 8 0.367 41 394 0 8 0.367 34 376 0 8 0.367 361 400 0 8 0.364 361 378 0 8 0.364 355 382 0 8 0.364 328 356 0 8 0.364 264 404 0 8 0.364 END