; SAM: /projects/compbio/bin/i686/prettyalign v3.5 (May 1, 2004) compiled 07/27/04_17:12:31 ; (c) 1992-2001 Regents of the University of California, Santa Cruz ; ; Sequence Alignment and Modeling Software System ; http://www.cse.ucsc.edu/research/compbio/sam.html ; ; ----------------- Citations (SAM, SAM-T2K, HMMs) -------------------- ; R. Hughey, A. Krogh, Hidden Markov models for sequence analysis: ; Extension and analysis of the basic method, CABIOS 12:95-107, 1996. ; K. Karplus, et al., What is the value added by human intervention in protein ; structure prediction, Proteins: Stucture, Function, Genetics 45(S5):86--91, 2001. ; A. Krogh et al., Hidden Markov models in computational biology: ; Applications to protein modeling, JMB 235:1501-1531, Feb 1994. ; --------------------------------------------------------------------- ; Sequences correspond to the following labels: ; 1 T0214 Hypothetical protein, Pyrococcus furiosus ; 2 T0213 Hypothetical protein, E. coli ; 3 T0227 TTHB84orF1350600, T. thermophilus 10 20 30 40 50 | | | | | 1 ME...WEMGLQEEFLELIKLRKKKIEGRLYDEK....RRQIKPGDVISFEGGK.......LKVRV 2 MQp..NDITFFQRFQDDILAGRKTITIR--DES....ESHFKTGDVLRVGRFE.......DDGYF 3 MErpkLGLIVREPYASLIVDGRKVWEIRRRKTRhrgpLGIVSGGRLIGQADLVgvegpfsVEELL 60 70 80 90 100 110 | | | | | | 1 KAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY 2 CTIEVTATSTVTLDTLTEKHAEQENMTLTELKKVIADIYPGQTQFYV----IEFKCL-- 3 AHQEKHLAEEAFLRAYAKDEPLYAWV-LENAFRYEKPLHVPRRPGRV--MFVDLSEVRW