CASP6 Target T0213
-
1. Protein Name
- hypothetical protein
-
2. Organism Name
- Escherichia coli
-
3. Number of amino acids (approx)
- 103
-
4. Accession number
- Q46828
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MQPNDITFFQRFQDDILAGRKTITIRDESESHFKTGDVLRVGRFEDDGYFCTIEVTATST
VTLDTLTEKHAEQENMTLTELKKVIADIYPGQTQFYVIEFKCL
-
7. Additional information
-
-
8. X-ray structure
- no
-
9. Current state of the experimental work
- 3D structure calculation has been completed
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- -
-
12. Estimated date of public release of structure
- November 2004
Related Files
Template Sequence file
Template PDB file