PFRMAT RR TARGET T0208 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximate of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MKWGFRWYGAAGDAIPLKHIRQIPGITGVVGTLLNKLPGDVWTVAEIQAL KQSVEQEGLALLGIESVAIHDAIKAGTDQRDHYIDNYRQTLRNLGKCGIS LVCYSFKPIFGWAKTDLAYENEDGSLSLLFDQAVVENMQPEDMYQLIHSQ SKGFRLPGWEEERLQQFQELKAMYAGVTEEDLVENLRYFLERVIPVCEEE NIKMGIHPDDPPWEIFGLPRITKNLADLKRILSLVDSPANGITFCTGSLG ADPTNDLPTMIREIGHRINFVHFRNVKYLGEHRFEETAHPSVAGSLDMAE LMQALVDVGYEGVIRPDHGRAIWDEKAMPGYGLYDRAMGLTYIQGLYEAT KAKQNRK 102 243 0 8 0.412 243 318 0 8 0.409 207 247 0 8 0.407 243 320 0 8 0.398 245 317 0 8 0.395 87 248 0 8 0.395 190 247 0 8 0.386 270 315 0 8 0.384 93 245 0 8 0.381 243 264 0 8 0.375 247 315 0 8 0.37 207 318 0 8 0.37 245 315 0 8 0.367 189 318 0 8 0.367 274 319 0 8 0.364 243 319 0 8 0.364 220 315 0 8 0.358 277 289 0 8 0.356 90 221 0 8 0.356 207 240 0 8 0.353 298 317 0 8 0.35 243 258 0 8 0.35 189 245 0 8 0.347 103 243 0 8 0.337 223 248 0 8 0.326 206 248 0 8 0.323 274 289 0 8 0.321 209 246 0 8 0.321 208 243 0 8 0.321 193 257 0 8 0.321 189 317 0 8 0.321 249 274 0 8 0.31 220 318 0 8 0.31 209 243 0 8 0.31 207 246 0 8 0.31 207 220 0 8 0.308 243 310 0 8 0.303 232 318 0 8 0.303 143 228 0 8 0.303 245 316 0 8 0.3 189 243 0 8 0.3 91 232 0 8 0.3 245 274 0 8 0.298 243 288 0 8 0.298 228 247 0 8 0.298 274 317 0 8 0.295 207 317 0 8 0.295 277 288 0 8 0.29 274 318 0 8 0.29 274 288 0 8 0.29 240 317 0 8 0.29 220 247 0 8 0.29 153 245 0 8 0.29 103 270 0 8 0.29 103 258 0 8 0.29 207 245 0 8 0.288 147 206 0 8 0.285 247 284 0 8 0.283 242 316 0 8 0.283 99 208 0 8 0.283 248 264 0 8 0.28 207 315 0 8 0.278 207 253 0 8 0.278 189 220 0 8 0.278 255 318 0 8 0.276 207 228 0 8 0.276 220 274 0 8 0.273 154 228 0 8 0.273 207 276 0 8 0.271 170 220 0 8 0.271 112 248 0 8 0.271 66 248 0 8 0.271 206 315 0 8 0.268 190 227 0 8 0.268 189 255 0 8 0.268 146 193 0 8 0.268 252 320 0 8 0.266 252 317 0 8 0.266 243 277 0 8 0.266 209 274 0 8 0.266 277 318 0 8 0.264 243 316 0 8 0.264 242 270 0 8 0.264 222 243 0 8 0.264 206 318 0 8 0.264 188 317 0 8 0.264 23 342 0 8 0.264 245 308 0 8 0.261 241 262 0 8 0.261 170 190 0 8 0.261 209 220 0 8 0.259 112 243 0 8 0.259 245 318 0 8 0.257 245 257 0 8 0.257 243 298 0 8 0.257 254 318 0 8 0.255 209 254 0 8 0.255 209 245 0 8 0.255 207 250 0 8 0.255 194 268 0 8 0.255 216 243 0 8 0.25 191 272 0 8 0.25 243 315 0 8 0.248 248 320 0 8 0.246 189 240 0 8 0.246 235 246 0 8 0.243 232 251 0 8 0.243 209 264 0 8 0.243 186 243 0 8 0.243 174 255 0 8 0.243 102 128 0 8 0.243 298 316 0 8 0.241 256 319 0 8 0.241 248 315 0 8 0.241 243 317 0 8 0.241 243 293 0 8 0.241 209 277 0 8 0.241 66 108 0 8 0.241 298 318 0 8 0.239 298 315 0 8 0.239 232 290 0 8 0.239 190 298 0 8 0.239 104 207 0 8 0.239 86 248 0 8 0.239 248 316 0 8 0.237 208 318 0 8 0.237 208 248 0 8 0.237 96 105 0 8 0.237 270 298 0 8 0.235 270 289 0 8 0.235 251 296 0 8 0.235 249 315 0 8 0.235 248 318 0 8 0.235 245 298 0 8 0.235 243 313 0 8 0.235 209 319 0 8 0.235 208 245 0 8 0.235 26 129 0 8 0.235 270 318 0 8 0.232 246 273 0 8 0.232 228 267 0 8 0.232 206 319 0 8 0.232 204 222 0 8 0.232 193 248 0 8 0.232 189 264 0 8 0.232 99 243 0 8 0.232 91 234 0 8 0.232 87 243 0 8 0.232 232 319 0 8 0.23 183 277 0 8 0.23 132 161 0 8 0.23 120 150 0 8 0.23 102 248 0 8 0.23 101 254 0 8 0.23 312 342 0 8 0.228 277 319 0 8 0.228 249 296 0 8 0.228 208 316 0 8 0.228 208 242 0 8 0.228 193 243 0 8 0.228 193 240 0 8 0.228 108 248 0 8 0.228 90 248 0 8 0.228 87 245 0 8 0.228 273 313 0 8 0.226 249 318 0 8 0.226 227 285 0 8 0.226 209 318 0 8 0.226 208 249 0 8 0.226 207 260 0 8 0.226 103 207 0 8 0.226 102 315 0 8 0.226 101 248 0 8 0.226 248 317 0 8 0.224 247 276 0 8 0.224 240 318 0 8 0.224 190 249 0 8 0.224 175 209 0 8 0.224 END